Novus Biologicals
Manufacturer Code:NBP254899
Catalog # NBP254899
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C20orf38 Chromosome 20 Open Reading Frame 38 dJ718P11 EC 2.3.1.50 hLCB2b LCB 3 LCB2B LCB3 Long Chain Base Biosynthesis Protein 2b Long Chain Base Biosynthesis Protein 3 Serine Palmitoyltransferase 3 Serine Palmitoyltransferase Long Chain Base Subunit 2-Like (Aminotransferase 2) Serine Palmitoyltransferase Long Chain Base Subunit 3 Serine-Palmitoyl-CoA Transferase 3 SPT 3 SPT3 SPTLC2L; LCB 3; LCB2b; Long chain base biosynthesis protein 2b; Long chain base biosynthesis protein 3; Serine palmitoyltransferase 3; serine palmitoyltransferase, long chain base subunit 2-like (aminotransferase 2); serine palmitoyltransferase, long chain base subunit 3; Serine-palmitoyl-CoA transferase 3; SPT 3
Gene Aliases: C20orf38; dJ718P11; dJ718P11.1; hLCB2b; LCB2B; LCB3; SPT3; SPTLC2L; SPTLC3
UniProt ID: (Human) Q9NUV7
Entrez Gene ID: (Human) 55304
Molecular Function: transaminase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.