Novus Biologicals
Manufacturer Code:NBP15964320UL
Catalog # NBP15964320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SPTLC1(serine palmitoyltransferase long chain base subunit 1) The peptide sequence was selected from the middle region of SPTLC1. Peptide sequence ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.3.1.50 hereditary sensory neuropathy type 1 HSAN1 LBC1 LCB 1 LCB1HSAN Long chain base biosynthesis protein 1 MGC14645 serine C-palmitoyltransferase serine palmitoyltransferase 1 serine palmitoyltransferase long chain base subunit 1 Serine-palmitoyl-CoA transferase 1 SPT 1 SPT1HSN1 SPTI; LCB 1; Long chain base biosynthesis protein 1; serine C-palmitoyltransferase; Serine palmitoyltransferase 1; serine palmitoyltransferase, long chain base subunit 1; Serine-palmitoyl-CoA transferase 1; SPT 1
Gene Aliases: HSAN1; HSN1; LBC1; LCB1; SPT1; SPTI; SPTLC1
UniProt ID: (Human) O15269
Entrez Gene ID: (Human) 10558
Molecular Function:
transaminase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.