Novus Biologicals
Manufacturer Code:NBP158172
Catalog # NBP158172
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SPO11(SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of SPO11. Peptide sequence KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNII |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cancer/testis antigen 35; Cancer/testis antigen 35 CT35MGC39953 meiotic recombination protein SPO11 SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae) SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae) SPO11 meiotic protein covalently bound to DSB (S. cerevisiae)-like; CT35; Meiotic recombination protein SPO11; spermatogenesis associated 43; SPO11 meiotic protein covalently bound to DSB homolog
Gene Aliases: CT35; SPATA43; SPO11; TOPVIA
UniProt ID: (Human) Q9Y5K1
Entrez Gene ID: (Human) 23626
Molecular Function: DNA binding protein nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.