Novus Biologicals
Manufacturer Code:NBP174237
Catalog # NBP174237
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the C terminal of SPDEF. Immunizing peptide sequence FKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA375E1.3 PDEFRP11-375E1__A.3 Prostate epithelium-specific Ets transcription factor Prostate-derived Ets factor Prostate-specific Ets PSE SAM pointed domain containing ets transcription factor SAM pointed domain-containing Ets transcription factor; Prostate epithelium-specific Ets transcription factor; Prostate-derived Ets factor; Prostate-specific Ets; SAM pointed domain-containing Ets transcription factor
Gene Aliases: bA375E1.3; PDEF; PSE; SPDEF
UniProt ID: (Human) F5H778
Entrez Gene ID: (Human) 25803
Molecular Function: nucleic acid binding signaling molecule transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.