Novus Biologicals
Manufacturer Code:NBP15688420UL
Catalog # NBP15688420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SPATA7(spermatogenesis associated 7) The peptide sequence was selected from the middle region of SPATA7. Peptide sequence FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: epididymis secretory protein Li 296; HSD-3.1; HSD-3.1 HSD3DKFZp686D07199 LCA3 Leber congenital amaurosis 3 MGC102934 spermatogenesis associated 7 spermatogenesis-associated protein 7 Spermatogenesis-associated protein HSD3; Spermatogenesis-associated protein 7; Spermatogenesis-associated protein HSD3
Gene Aliases: HEL-S-296; HSD-3.1; HSD3; LCA3; SPATA7
UniProt ID: (Human) Q9P0W8
Entrez Gene ID: (Human) 55812
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.