Novus Biologicals
Manufacturer Code:NBP15462820UL
Catalog # NBP15462820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SPAG8(sperm associated antigen 8) The peptide sequence was selected from the middle region of SPAG8. Peptide sequence PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BS-84 HSD-1MGC26201 hSMP-1 SMP1 SMP-1 SPAG3 sperm associated antigen 8 Sperm membrane protein 1 Sperm membrane protein BS-84 sperm-associated antigen 8; HSD-1; SMP-1; Sperm membrane protein 1; Sperm membrane protein BS-84; Sperm-associated antigen 8; testicular tissue protein Li 177
Gene Aliases: BS-84; CILD28; CT142; HSD-1; hSMP-1; SMP1; SPAG3; SPAG8
UniProt ID: (Human) Q99932
Entrez Gene ID: (Human) 26206
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.