Novus Biologicals
Manufacturer Code:NBP238707
Catalog # NBP238707
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: epididymis secretory protein Li 268; FLJ32920 HSD-3.8sperm-associated antigen 1 Infertility-related sperm protein Spag-1 SP75 sperm associated antigen 1 tetratricopeptide repeat-containing protein TPIS TPR-containing protein involved in spermatogenesis; HSD-3.8; Infertility-related sperm protein Spag-1; Sperm-associated antigen 1; tetratricopeptide repeat-containing protein; TPR-containing protein involved in spermatogenesis
Gene Aliases: CILD28; CT140; HEL-S-268; HSD-3.8; SP75; SPAG1; TPIS
UniProt ID: (Human) Q07617
Entrez Gene ID: (Human) 6674
Molecular Function:
chaperone
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.