Novus Biologicals
Manufacturer Code:NBP174096
Catalog # NBP174096
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the C terminal of SOX5 (NP_821078). Immunizing peptide sequence PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: L-SOX5 MGC35153 SRY (sex determining region Y)-box 5 transcription factor SOX-5; SRY (sex determining region Y)-box 5; SRY box 5; Transcription factor SOX-5
Gene Aliases: L-SOX5; L-SOX5B; L-SOX5F; LAMSHF; SOX5
UniProt ID: (Human) P35711
Entrez Gene ID: (Human) 6660
Molecular Function: HMG box transcription factor nucleic acid binding transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.