Novus Biologicals
Manufacturer Code:NBP15717320UL
Catalog # NBP15717320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SNRPD2(small nuclear ribonucleoprotein D2 polypeptide 16.5kDa) The peptide sequence was selected from the N terminal of SNRPD2. Peptide sequence MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Sm-D2; small nuclear ribonucleoprotein D2 polypeptide (16.5kD) small nuclear ribonucleoprotein D2 polypeptide 16.5kDa small nuclear ribonucleoprotein Sm D2 Sm-D2SMD2 snRNP core protein D2 SNRPD1; small nuclear ribonucleoprotein D2 polypeptide 16.5kDa; Small nuclear ribonucleoprotein Sm D2; snRNP core protein D2
Gene Aliases: Sm-D2; SMD2; SNRPD1; SNRPD2
UniProt ID: (Human) P62316
Entrez Gene ID: (Human) 6633
Molecular Function:
RNA binding protein
mRNA processing factor
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.