Novus Biologicals
Manufacturer Code:NBP157488
Catalog # NBP157488
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SNRP70 (small nuclear ribonucleoprotein 70kDa polypeptide (RNP antigen)) The peptide sequence was selected from the N terminal of SNRP70. Peptide sequence YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERM |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: RNPU1ZU170K RPU1U1AP small nuclear ribonucleoprotein 70kDa (U1) Snp1 snRNP70 SNRP70U1 small nuclear ribonucleoprotein 70 kDa U1 snRNP 70 kDa U1-70Ksmall nuclear ribonucleoprotein 70kDa (RNP antigen) U1AP1 U1RNP; small nuclear ribonucleoprotein 70kDa (U1); small nuclear ribonucleoprotein, U1 70kDa subunit; U1 small nuclear ribonucleoprotein 70 kDa; U1 snRNP 70 kDa
Gene Aliases: RNPU1Z; RPU1; Snp1; SNRNP70; SNRP70; U1-70K; U170K; U1AP; U1AP1; U1RNP
UniProt ID: (Human) P08621
Entrez Gene ID: (Human) 6625
Molecular Function: RNA binding protein mRNA processing factor mRNA splicing factor nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.