Novus Biologicals
Manufacturer Code:NBP174114
Catalog # NBP174114
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the N terminal of Smpdl3a. Immunizing peptide sequence YQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 0610010C24Rik; 0610010C24Rik acid sphingomyelinase-like phosphodiesterase 3a ASM3A ASML3a ASM-like phosphodiesterase 3a EC 3.1.4 EC 3.1.4.- FLJ20177 sphingomyelin phosphodiesterase acid-like 3A yR36GH4.1; Acid sphingomyelinase-like phosphodiesterase 3a; ASM-like phosphodiesterase 3a; sphingomyelin phosphodiesterase acid-like 3A; sphingomyelin phosphodiesterase, acid-like 3A
Gene Aliases: ASM3A; ASML3A; SMPDL3A; yR36GH4.1
UniProt ID: (Human) Q92484
Entrez Gene ID: (Human) 10924
Molecular Function: hydrolase phosphodiesterase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.