Novus Biologicals
Manufacturer Code:NBP255775
Catalog # NBP255775
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HDKPVNAESQNSVGVFTREEVRNRIRNDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFMRVVE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C20orf16 chromosome 20 open reading frame 16 EC 1.5.3.16 flavin containing amine oxidase flavin-containing spermine oxidase FLJ20746 MGC1010 PAO PAO-1 PAOh1 Polyamine oxidase 1 putative cyclin G1 interacting protein SMOdJ779E11.1 spermine oxidase; flavin containing amine oxidase; flavin-containing spermine oxidase; PAO-1; Polyamine oxidase 1; putative cyclin G1 interacting protein; Spermine oxidase
Gene Aliases: C20orf16; PAO; PAO-1; PAO1; PAOH; PAOH1; SMO; SMOX; UNQ3039/PRO9854
UniProt ID: (Human) Q9NWM0
Entrez Gene ID: (Human) 54498
Molecular Function: DNA binding protein DNA methyltransferase methyltransferase nucleic acid binding oxidase oxidoreductase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.