Novus Biologicals
Manufacturer Code:NBP233378
Catalog # NBP233378
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ22116 hSMC6 SMC protein 6 SMC-6 SMC6 structural maintenance of chromosomes 6-like 1 SMC6 structural maintenance of chromosomes 6-like 1 (yeast) SMC6L1FLJ35534 structural maintenance of chromosomes 6 structural maintenance of chromosomes protein 6; SMC protein 6; SMC6 structural maintenance of chromosomes 6-like 1; Structural maintenance of chromosomes protein 6
Gene Aliases: hSMC6; SMC-6; SMC6; SMC6L1
UniProt ID: (Human) Q96SB8
Entrez Gene ID: (Human) 79677
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.