Novus Biologicals
Manufacturer Code:NBP238986
Catalog # NBP238986
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.6.1 EC 3.6.4.- helicase lymphoid-specific LSHSWI/SNF2-related matrix-associated actin-dependent regulator of chromatin Nbla10143 PASGFLJ10339 Proliferation-associated SNF2-like protein SMARCA6lymphoid-specific helicase subfamily A member 6 SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6; Lymphoid-specific helicase; Proliferation-associated SNF2-like protein; SWI/SNF2-related matrix-associated actin-dependent regulator of chromatin subfamily A member 6; SWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, subfamily A, member 6
Gene Aliases: HELLS; ICF4; LSH; Nbla10143; PASG; SMARCA6
UniProt ID: (Human) Q6I7N7
Entrez Gene ID: (Human) 3070
Molecular Function:
DNA binding protein
DNA helicase
helicase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.