Novus Biologicals
Manufacturer Code:NBP256758
Catalog # NBP256758
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hSMAD6 HsT17432 MAD homolog 6 MADH6SMAD mothers against DPP homolog 6 (Drosophila) MADH7 mothers against decapentaplegic homolog 6 Mothers against decapentaplegic drosophila homolog of 6 Mothers against DPP homolog 6 SMAD 6 SMAD family member 6MAD mothers against decapentaplegic homolog 6 (Drosophila) SMAD mothers against DPP homolog 6 Smad6; MAD homolog 6; Mothers against decapentaplegic homolog 6; mothers against decapentaplegic, drosophila, homolog of, 6; SMAD 6; SMAD family member 6; SMAD, mothers against DPP homolog 6
Gene Aliases: AOVD2; HsT17432; MADH6; MADH7; SMAD6
UniProt ID: (Human) O43541
Entrez Gene ID: (Human) 4091
Molecular Function:
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.