Novus Biologicals
Manufacturer Code:NBP17990320UL
Catalog # NBP17990320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The specific Immunogen is proprietary information. Peptide sequence VTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EPB72-like 2; EPB72-like protein 2; EPB72-like protein 2 HSPC108 SLP2 SLP-2stomatin-like protein 2 stomatin (EPB72)-like 2 stomatin-like 2; Paraprotein target 7; Paratarg-7; SLP-2; stomatin (EPB72)-like 2; stomatin-like 2; Stomatin-like protein 2, mitochondrial
Gene Aliases: HSPC108; SLP-2; SLP2; STOML2
UniProt ID: (Human) Q9UJZ1
Entrez Gene ID: (Human) 30968
Molecular Function:
cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.