Novus Biologicals
Manufacturer Code:NBP16242520UL
Catalog # NBP16242520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLITRK6(SLIT and NTRK-like family member 6) The peptide sequence was selected from the N terminal of SLITRK6. Peptide sequence NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4832410J21Rik; FLJ22774 MGC119595 MGC119596 MGC1195974832410J21Rik SLIT and NTRK-like family member 6 SLIT and NTRK-like protein 6 slit and trk like gene 6; SLIT and NTRK-like family, member 6; SLIT and NTRK-like protein 6; slit and trk like gene 6
Gene Aliases: DFNMYP; SLITRK6
UniProt ID: (Human) Q9H5Y7
Entrez Gene ID: (Human) 84189
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.