Novus Biologicals
Manufacturer Code:NBP159811
Catalog # NBP159811
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLCO2B1(solute carrier organic anion transporter family member 2B1) The peptide sequence was selected from the N terminal of SLCO2B1. Peptide sequence DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: OATP-B; OATP-RP2; OATP2B1OATP-RP2 OATPBDKFZp686E0517 OATP-BKIAA0880 OATPRP2 Organic anion transporter B Organic anion transporter polypeptide-related protein 2 SLC21A9solute carrier organic anion transporter family member 2B1 solute carrier family 21 (organic anion transporter) member 9 Solute carrier family 21 member 9 solute carrier organic anion transporter family member 2B1; Organic anion transporter B; Organic anion transporter polypeptide-related protein 2; solute carrier family 21 (organic anion transporter), member 9; Solute carrier family 21 member 9; Solute carrier organic anion transporter family member 2B1; solute carrier organic anion transporter family, member 2B1
Gene Aliases: KIAA0880; OATP-B; OATP2B1; OATPB; SLC21A9; SLCO2B1
UniProt ID: (Human) O94956
Entrez Gene ID: (Human) 11309
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.