Novus Biologicals
Manufacturer Code:NBP213349
Catalog # NBP213349
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMS SATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: matrin F/G 1; OATP2A1member 2 PGTmatrin F/G 1 Prostaglandin transporter Solute carrier family 21 member 2 solute carrier organic anion transporter family member 2A1 solute carrier organic anion transporter family member 2A1; PGT; Prostaglandin transporter; solute carrier family 21 (prostaglandin transporter), member 2; Solute carrier family 21 member 2; Solute carrier organic anion transporter family member 2A1; solute carrier organic anion transporter family, member 2A1
Gene Aliases: MATR1; OATP2A1; PGT; PHOAR2; SLC21A2; SLCO2A1
UniProt ID: (Human) Q92959
Entrez Gene ID: (Human) 6578
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.