Novus Biologicals
Manufacturer Code:NBP180997
Catalog # NBP180997
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ASPPCNQAPILTCLPPHPRGTEEPQVPLHLPSDPRSSFAFPPSLAKAGRSRSESSADLPQQQELQPLMGHKDHTHL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Na(+)/H(+) exchanger 5; Na(+)/H(+) exchanger 5 NHE-5 NHE5solute carrier family 9 (sodium/hydrogen exchanger) isoform 5 sodium/hydrogen exchanger 5 solute carrier family 9 (sodium/hydrogen exchanger) solute carrier family 9 (sodium/hydrogen exchanger) member 5 Solute carrier family 9 member 5; NHE-5; Sodium/hydrogen exchanger 5; solute carrier family 9 (sodium/hydrogen exchanger), isoform 5; solute carrier family 9 (sodium/hydrogen exchanger), member 5; Solute carrier family 9 member 5; solute carrier family 9, subfamily A (NHE5, cation proton antiporter 5), member 5
Gene Aliases: NHE5; SLC9A5
UniProt ID: (Human) Q14940
Entrez Gene ID: (Human) 6553
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.