Novus Biologicals
Manufacturer Code:NBP192409
Catalog # NBP192409
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:YKFGWAQKISKPITMHLQMLMEVVPPEEDPE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: b(0+)AT B(0+)-type amino acid transporter 1 BAT1 bo+ amino acid transporter CSNU3 FLJ94301 Glycoprotein-associated amino acid transporter b0+AT1 solute carrier family 7 (cationic amino acid transporter y+ system) member 9 Solute carrier family 7 member 9; b(0,+)-type amino acid transporter 1; b(0,+)AT; b(0,+)AT1; Glycoprotein-associated amino acid transporter b0,+AT1; solute carrier family 7 (amino acid transporter light chain, bo,+ system), member 9; solute carrier family 7 (cationic amino acid transporter, y+ system), member 9; solute carrier family 7 (glycoprotein-associated amino acid transporter light chain, bo,+ system), member 9; Solute carrier family 7 member 9
Gene Aliases: BAT1; CSNU3; SLC7A9
UniProt ID: (Human) P82251
Entrez Gene ID: (Human) 11136
Molecular Function: amino acid transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.