Novus Biologicals
Manufacturer Code:NBP159856
Catalog # NBP159856
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC7A7(solute carrier family 7 (cationic amino acid transporter y+ system) member 7) The peptide sequence was selected from the middle region of SLC7A7. Peptide sequence WGTLVQDIFTYAKVLALIAVIVAGIVRLGQG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: LAT3 LPI Monocyte amino acid permease 2 MOP-2 solute carrier family 7 (cationic amino acid transporter y+ system) member 7 Solute carrier family 7 member 7 Y+L amino acid transporter 1 Y+LAT1 y+LAT-1y(+)L-type amino acid transporter 1; Monocyte amino acid permease 2; MOP-2; solute carrier family 7 (amino acid transporter light chain, y+L system), member 7; solute carrier family 7 (cationic amino acid transporter, y+ system), member 7; Solute carrier family 7 member 7; y(+)L-type amino acid transporter 1; Y+L amino acid transporter 1; Y+LAT1
Gene Aliases: LAT3; LPI; MOP-2; SLC7A7; y+LAT-1; Y+LAT1
UniProt ID: (Human) Q9UM01
Entrez Gene ID: (Human) 9056
Molecular Function:
amino acid transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.