Novus Biologicals
Manufacturer Code:NBP233662
Catalog # NBP233662
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 4F2 LC; 4F2 LC CD98 CD98LC D16S469EL-type amino acid transporter 1 E16 Integral membrane protein E16 large neutral amino acids transporter 1 large neutral amino acids transporter small subunit 1 LAT1hLAT1 MPE16CD98 light chain sodium-independent neutral amino acid transporter LAT14F2LC solute carrier family 7 (cationic amino acid transporter y+ system) member 54F2 light chain Solute carrier family 7 member 5 y+ system cationic amino acid transporter; 4F2 light chain; CD98 light chain; E16; hLAT1; Integral membrane protein E16; L-type amino acid transporter 1; large neutral amino acids transporter 1; Large neutral amino acids transporter small subunit 1; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (amino acid transporter light chain, L system), member 5; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; Solute carrier family 7 member 5; y+ system cationic amino acid transporter
Gene Aliases: 4F2LC; CD98; CD98LC; D16S469E; E16; hLAT1; LAT1; MPE16; SLC7A5
UniProt ID: (Human) Q01650
Entrez Gene ID: (Human) 8140
Molecular Function:
amino acid transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.