Novus Biologicals
Manufacturer Code:NBP15975020UL
Catalog # NBP15975020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC7A4(solute carrier family 7 (cationic amino acid transporter y+ system) member 4) The peptide sequence was selected from the middle region of SLC7A4. Peptide sequence GAYILVSTVLTLMVPWHSLDPDSALADAFYQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CAT-4; CAT4cationic amino acid transporter 4 CAT-4MGC129977 HCAT3 Ig heavy chain variable region MGC129976 solute carrier family 7 (cationic amino acid transporter y+ system) member 4 Solute carrier family 7 member 4 VH VH 3 family; Cationic amino acid transporter 4; Ig heavy chain variable region; solute carrier family 7 (cationic amino acid transporter, y+ system), member 4; solute carrier family 7 (orphan transporter), member 4; Solute carrier family 7 member 4; solute carrier family 7, member 4; VH 3 family
Gene Aliases: CAT-4; CAT4; HCAT3; SLC7A4; VH
UniProt ID: (Human) O43246
Entrez Gene ID: (Human) 6545
Molecular Function:
amino acid transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.