Novus Biologicals
Manufacturer Code:NBP159872
Catalog # NBP159872
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC7A2(solute carrier family 7 (cationic amino acid transporter y+ system) member 2) The peptide sequence was selected from the middle region of SLC7A2 (NP_001008539). Peptide sequence VANWKISEEFLKNISASAREPPSENGTSIYG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CAT-2; CAT2 CAT-2 cationic 2 cationic amino acid transporter y+ system low affinity cationic amino acid transporter 2 low-affinity cationic amino acid transporter-2 solute carrier family 7 (cationic amino acid transporter y+ system) member 2 Solute carrier family 7 member 2; Cationic amino acid transporter 2; Low affinity cationic amino acid transporter 2; solute carrier family 7 (cationic amino acid transporter, y+ system), member 2; Solute carrier family 7 member 2
Gene Aliases: ATRC2; CAT2; HCAT2; SLC7A2
UniProt ID: (Human) P52569
Entrez Gene ID: (Human) 6542
Molecular Function:
amino acid transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.