Novus Biologicals
Manufacturer Code:NBP257729
Catalog # NBP257729
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 5-hydroxytryptamine (serotonin) transporter; 5HT transporter; 5HT transporter 5-HTT hSERT HTT5-hydroxytryptamine transporter Na+/Cl- dependent serotonin transporter OCD1 SERT sodium-dependent serotonin transporter solute carrier family 6 (neurotransmitter transporter serotonin) member 45-HTTLPR Solute carrier family 6 member 45HTT; 5HTT; Na+/Cl- dependent serotonin transporter; serotonin transporter 1; SERT; Sodium-dependent serotonin transporter; solute carrier family 6 (neurotransmitter transporter), member 4; solute carrier family 6 (neurotransmitter transporter, serotonin), member 4; Solute carrier family 6 member 4
Gene Aliases: 5-HTT; 5-HTTLPR; 5HTT; hSERT; HTT; OCD1; SERT; SERT1; SLC6A4
UniProt ID: (Human) P31645
Entrez Gene ID: (Human) 6532
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.