Novus Biologicals
Manufacturer Code:NBP159873
Catalog # NBP159873
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC5A9(solute carrier family 5 (sodium/glucose cotransporter) member 9) The peptide sequence was selected from the N terminal of SLC5A9. Peptide sequence MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hSGLT4; hSGLT4 MGC132523 Na(+)/glucose cotransporter 4 SGLT4MGC132517 sodium/glucose cotransporter 4 solute carrier family 5 (sodium/glucose cotransporter) member 9 Solute carrier family 5 member 9; Na(+)/glucose cotransporter 4; Sodium/glucose cotransporter 4; solute carrier family 5 (sodium/glucose cotransporter), member 9; solute carrier family 5 (sodium/sugar cotransporter), member 9; Solute carrier family 5 member 9
Gene Aliases: SGLT4; SLC5A9
UniProt ID: (Human) Q5TET3
Entrez Gene ID: (Human) 200010
Molecular Function:
carbohydrate transporter
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.