Novus Biologicals
Manufacturer Code:NBP233547
Catalog # NBP233547
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Na(+)/I(-) cotransporter; Na(+)/I(-) cotransporter Na(+)/I(-) symporter NISNa(+)/I(-)-symporter sodium/iodide cotransporter Sodium-iodide symporter solute carrier family 5 (sodium iodide symporter) member 5 Solute carrier family 5 member 5 TDH1; Na(+)/I(-) symporter; Sodium-iodide symporter; Sodium/iodide cotransporter; solute carrier family 5 (sodium iodide symporter), member 5; solute carrier family 5 (sodium/iodide cotransporter), member 5; Solute carrier family 5 member 5
Gene Aliases: NIS; SLC5A5; TDH1
UniProt ID: (Human) Q92911
Entrez Gene ID: (Human) 6528
Molecular Function:
carbohydrate transporter
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.