Novus Biologicals
Manufacturer Code:NBP233476
Catalog # NBP233476
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C6orf29 Choline Transporter-Like Protein 4 Chromosome 6 Open Reading Frame 29 CTL4 NG22 Solute Carrier Family 44 Member 4 Solute Carrier Family 44 Member 4; Choline transporter-like protein 4; hTPPT1; Solute carrier family 44 member 4; solute carrier family 44, member 4; testicular tissue protein Li 48; thiamine pyrophosphate transporter; Thiamine pyrophosphate transporter 1
Gene Aliases: C6orf29; CTL4; NG22; SLC44A4; TPPT; TPPT1; UNQ441/PRO874
UniProt ID: (Human) Q53GD3
Entrez Gene ID: (Human) 80736
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.