Novus Biologicals
Manufacturer Code:NBP159693
Catalog # NBP159693
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC41A1(solute carrier family 41 member 1) The peptide sequence was selected from the N terminal of SLC41A1. Peptide sequence TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: MgtE solute carrier family 41 member 1 solute carrier family 41 member 1; solute carrier family 41 (magnesium transporter), member 1; Solute carrier family 41 member 1; solute carrier family 41, member 1
Gene Aliases: MgtE; SLC41A1
UniProt ID: (Human) Q8IVJ1
Entrez Gene ID: (Human) 254428
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.