Novus Biologicals
Manufacturer Code:NBP15984120UL
Catalog # NBP1598420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC39A9 (solute carrier family 39 (zinc transporter) member 9) The peptide sequence was selected from the middle region of SLC39A9)(50ug). Peptide sequence YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ11274 MGC74989 solute carrier family 39 (zinc transporter) member 9 Solute carrier family 39 member 9 zinc transporter SLC39A9 zinc transporter ZIP9 ZIP9 ZIP-9 Zrt- and Irt-like protein 9; solute carrier family 39 (zinc transporter), member 9; Solute carrier family 39 member 9; solute carrier family 39, member 9; zinc transporter SLC39A9; Zinc transporter ZIP9; ZIP-9; Zrt- and Irt-like protein 9
Gene Aliases: SLC39A9; UNQ714/PRO1377; ZIP-9; ZIP9
UniProt ID: (Human) Q9NUM3
Entrez Gene ID: (Human) 55334
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.