Novus Biologicals
Manufacturer Code:NBP169296
Catalog # NBP169296
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC39A5(solute carrier family 39 (metal ion transporter) member 5) The peptide sequence was selected from the N terminal of SLC39A5. Peptide sequence MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: LZT-Hs7 MGC34778 solute carrier family 39 (metal ion transporter) member 5 Solute carrier family 39 member 5 zinc transporter ZIP5 ZIP5 ZIP-5 Zrt- and Irt-like protein 5; solute carrier family 39 (metal ion transporter), member 5; solute carrier family 39 (zinc transporter), member 5; Solute carrier family 39 member 5; Zinc transporter ZIP5; ZIP-5; Zrt- and Irt-like protein 5
Gene Aliases: LZT-Hs7; MYP24; SLC39A5; ZIP5
UniProt ID: (Human) Q6ZMH5
Entrez Gene ID: (Human) 283375
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.