Novus Biologicals
Manufacturer Code:NBP186830
Catalog # NBP186830
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 6A1; Eti-1; Eti-1 MGC119190 solute carrier family 39 (zinc transporter) member 2 Solute carrier family 39 member 2 zinc transporter ZIP2 ZIP-2 ZIP2hZIP2 Zrt- and Irt-like protein 26A1; solute carrier family 39 (zinc transporter), member 2; Solute carrier family 39 member 2; Zinc transporter ZIP2; zinc uptake transporter 2; ZIP-2; Zrt- and Irt-like protein 2
Gene Aliases: 6A1; ETI-1; SLC39A2; ZIP-2; ZIP2
UniProt ID: (Human) Q9NP94
Entrez Gene ID: (Human) 29986
Molecular Function:
transmembrane receptor regulatory/adaptor protein
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.