Novus Biologicals
Manufacturer Code:NBP16252820UL
Catalog # NBP16252820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC39A12(solute carrier family 39 (zinc transporter) member 12) The peptide sequence was selected from the N terminal of SLC39A12. Peptide sequence MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA570F3.1 FLJ30499 LIV-1 subfamily of ZIP zinc transporter 8 LZT-Hs8 MGC43205 MGC51099 solute carrier family 39 (metal ion transporter) member 12 solute carrier family 39 (zinc transporter) member 12 Solute carrier family 39 member 12 zinc transporter ZIP12 ZIP12 ZIP-12 Zrt- and Irt-like protein 12; LIV-1 subfamily of ZIP zinc transporter 8; LZT-Hs8; solute carrier family 39 (metal ion transporter), member 12; solute carrier family 39 (zinc transporter), member 12; Solute carrier family 39 member 12; Zinc transporter ZIP12; ZIP-12; Zrt- and Irt-like protein 12
Gene Aliases: bA570F3.1; LZT-Hs8; SLC39A12; ZIP-12; ZIP12
UniProt ID: (Human) Q504Y0
Entrez Gene ID: (Human) 221074
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.