Novus Biologicals
Manufacturer Code:NBP238306
Catalog # NBP238306
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp564L2123 DKFZp781L10106 FLJ90515 KIAA1265 LZT-Hs2 MGC126565 MGC138428 solute carrier family 39 (metal ion transporter) member 10 solute carrier family 39 (zinc transporter) member 10 Solute carrier family 39 member 10 zinc transporter ZIP10 ZIP10 ZIP-10 Zrt- and Irt-like protein 10; solute carrier family 39 (metal ion transporter), member 10; solute carrier family 39 (zinc transporter), member 10; Solute carrier family 39 member 10; Zinc transporter ZIP10; ZIP-10; Zrt- and Irt-like protein 10
Gene Aliases: KIAA1265; LZT-Hs2; SLC39A10; ZIP10
UniProt ID: (Human) Q9ULF5
Entrez Gene ID: (Human) 57181
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.