Novus Biologicals
Manufacturer Code:NBP192402
Catalog # NBP192402
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: SN2JM24pp7194 SNAT5 sodium-coupled neutral amino acid transporter 5 Solute carrier family 38 member 5 solute carrier family 38 member 5 System N transporter 2; Sodium-coupled neutral amino acid transporter 5; solute carrier family 38 (amino acid transporter), member 5; Solute carrier family 38 member 5; solute carrier family 38, member 5; System N transporter 2; transport system N, protein 2
Gene Aliases: JM24; PP7194; SLC38A5; SN2; SNAT5
UniProt ID: (Human) Q8WUX1
Entrez Gene ID: (Human) 92745
Molecular Function: amino acid transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.