Novus Biologicals
Manufacturer Code:NBP159895
Catalog # NBP159895
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC38A5(solute carrier family 38 member 5) The peptide sequence was selected from the N terminal of SLC38A5. Peptide sequence GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: SN2JM24pp7194 SNAT5 sodium-coupled neutral amino acid transporter 5 Solute carrier family 38 member 5 solute carrier family 38 member 5 System N transporter 2; Sodium-coupled neutral amino acid transporter 5; solute carrier family 38 (amino acid transporter), member 5; Solute carrier family 38 member 5; solute carrier family 38, member 5; System N transporter 2; transport system N, protein 2
Gene Aliases: JM24; PP7194; SLC38A5; SN2; SNAT5
UniProt ID: (Human) Q8WUX1
Entrez Gene ID: (Human) 92745
Molecular Function: amino acid transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.