Novus Biologicals
Manufacturer Code:NBP258073
Catalog # NBP258073
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KFHVPCPLPPNFNNTTGNFSHVEIVKEKVQLQVEPEASAFCTPSYFTLNSQT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: G17sodium-coupled neutral amino acid transporter 3 Na(+)-coupled neutral amino acid transporter 3 NAT1 N-system amino acid transporter 1 SN1system N1 Na+ and H+-coupled glutamine transporter SNAT3 Solute carrier family 38 member 3 solute carrier family 38 member 3 System N amino acid transporter 1; N-system amino acid transporter 1; Na(+)-coupled neutral amino acid transporter 3; SLC38A3; Sodium-coupled neutral amino acid transporter 3; Solute carrier family 38 member 3; solute carrier family 38, member 3; System N amino acid transporter 1; system N1 Na+ and H+-coupled glutamine transporter
Gene Aliases: G17; NAT1; SLC38A3; SN1; SNAT3
UniProt ID: (Human) Q99624
Entrez Gene ID: (Human) 10991
Molecular Function: amino acid transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.