Novus Biologicals
Manufacturer Code:NBP159649
Catalog # NBP159649
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC38A1(solute carrier family 38 member 1) The peptide sequence was selected from the middle region of SLC38A1. Peptide sequence LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Amino acid transporter A1; Amino acid transporter A1 ATA1SNAT1 NAT2N-system amino acid transporter 2 SAT1amino acid transporter system A1 sodium-coupled neutral amino acid transporter 1 Solute carrier family 38 member 1 solute carrier family 38 member 1 System A amino acid transporter 1 System N amino acid transporter 1; amino acid transporter system A1; N-system amino acid transporter 2; Sodium-coupled neutral amino acid transporter 1; Solute carrier family 38 member 1; solute carrier family 38, member 1; System A amino acid transporter 1; System N amino acid transporter 1
Gene Aliases: ATA1; NAT2; SAT1; SLC38A1; SNAT1
UniProt ID: (Human) Q9H2H9
Entrez Gene ID: (Human) 81539
Molecular Function: amino acid transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.