Novus Biologicals
Manufacturer Code:NBP159877
Catalog # NBP159877
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC37A4(solute carrier family 37 (glucose-6-phosphate transporter) member 4) The peptide sequence was selected from the N terminal of SLC37A4. Peptide sequence LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: G6PT G6PT1G6PT3 G6PT2 Glucose-5-phosphate transporter glucose-6-phosphatase transport (glucose) protein 3 glucose-6-phosphatase transport (glucose-6-phosphate) protein 1 glucose-6-phosphatase transport (phosphate/pyrophosphate) protein 2 glucose-6-phosphate translocase GSD1b GSD1c GSD1d MGC15729 microsomal glucose-6-phosphate transporter solute carrier family 37 (glucose-6-phosphate transporter) member 4 Solute carrier family 37 member 4 Transformation-related gene 19 protein TRG19 TRG-19; Glucose-5-phosphate transporter; glucose-6-phosphatase, transport (glucose) protein 3; glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1; glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2; Glucose-6-phosphate exchanger SLC37A4; Glucose-6-phosphate translocase; microsomal glucose-6-phosphate transporter; solute carrier family 37 (glucose-6-phosphate transporter), member 4; Solute carrier family 37 member 4; Transformation-related gene 19 protein; TRG-19
Gene Aliases: G6PT; G6PT1; G6PT2; G6PT3; GSD1b; GSD1c; GSD1d; PRO0685; SLC37A4; TRG-19; TRG19
UniProt ID: (Human) O43826
Entrez Gene ID: (Human) 2542
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.