Novus Biologicals
Manufacturer Code:NBP183879
Catalog # NBP183879
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RKPISIVKSRLHQNCSEQIKPINDTHSLNDTMWCSWAPFDKDNYKE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ00171 MGC71430 pp11662 solute carrier family 37 (glycerol-3-phosphate transporter) member 2 Solute carrier family 37 member 2 SPX2 sugar phosphate exchanger 2; Glucose-6-phosphate exchanger SLC37A2; solute carrier family 37 (glucose-6-phosphate transporter), member 2; solute carrier family 37 (glycerol-3-phosphate transporter), member 2; Solute carrier family 37 member 2; sugar phosphate exchanger 2
Gene Aliases: pp11662; SLC37A2
UniProt ID: (Human) Q8TED4
Entrez Gene ID: (Human) 219855
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.