Novus Biologicals
Manufacturer Code:NBP159418
Catalog # NBP159418
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for anti-SLC36A2 antibody: synthetic peptide directed towards the N terminal of human SLC36A2 . Peptide sequence: TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ16051 MGC119658 MGC119660 PAT2proton-coupled amino acid transporter 2 Proton/amino acid transporter 2 solute carrier family 36 (proton/amino acid symporter) member 2 Solute carrier family 36 member 2 TRAMD1tramdorin-1 tramdorin Tramdorin-1; Proton-coupled amino acid transporter 2; Proton/amino acid transporter 2; solute carrier family 36 (proton/amino acid symporter), member 2; Solute carrier family 36 member 2; Tramdorin-1
Gene Aliases: PAT2; SLC36A2; TRAMD1
UniProt ID: (Human) Q495M3
Entrez Gene ID: (Human) 153201
Molecular Function: amino acid transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.