Novus Biologicals
Manufacturer Code:NBP159386
Catalog # NBP159386
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC35C1(solute carrier family 35 member C1) The peptide sequence was selected from the N terminal of SLC35C1. Peptide sequence TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDG2C FLJ11320 FLJ14841 FUCT1GDP-fucose transporter 1 Solute carrier family 35 member C1 solute carrier family 35 member C1; GDP-fucose transporter 1; solute carrier family 35 (GDP-fucose transporter), member C1; Solute carrier family 35 member C1; solute carrier family 35, member C1
Gene Aliases: CDG2C; FUCT1; SLC35C1
UniProt ID: (Human) Q96A29
Entrez Gene ID: (Human) 55343
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.