Novus Biologicals
Manufacturer Code:NBP181933
Catalog # NBP181933
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVAGSVLKACG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Na(+)-dependent phosphate cotransporter 2C; Na(+)/Pi cotransporter 2C; Na(+)/Pi cotransporter 2C Na(+)-dependent phosphate cotransporter 2C naPi-2c sodium-phosphate transport protein 2C solute carrier family 34 (sodium phosphate) member 3; naPi-2c; Sodium-dependent phosphate transport protein 2C; Sodium-phosphate transport protein 2C; Sodium/inorganic phosphate cotransporter IIC; Sodium/phosphate cotransporter 2C; solute carrier family 34 (sodium phosphate), member 3; solute carrier family 34 (type II sodium/phosphate cotransporter), member 3; Solute carrier family 34 member 3; type IIc Na+/Pi cotransporter
Gene Aliases: HHRH; NPT2C; NPTIIC; SLC34A3
UniProt ID: (Human) Q8N130
Entrez Gene ID: (Human) 142680
Molecular Function:
enzyme modulator
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.