Novus Biologicals
Manufacturer Code:NBP231673
Catalog # NBP231673
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: MGC45055 MST103 MSTP103 solute carrier family 30 (zinc transporter) member 6 Solute carrier family 30 member 6 zinc transporter 6 ZnT-6 ZNT6FLJ31101; solute carrier family 30 (zinc transporter), member 6; Solute carrier family 30 member 6; Zinc transporter 6; ZnT-6
Gene Aliases: MST103; MSTP103; SLC30A6; ZNT6
UniProt ID: (Human) Q6NXT4
Entrez Gene ID: (Human) 55676
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.