Novus Biologicals
Manufacturer Code:NBP182299
Catalog # NBP182299
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SSPSKRGQKGTLIGYSPEGTPLYNFMGDAFQHSSQSIPRFIKESLKQILEESDSRQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ12756 MGC5499 solute carrier family 30 (zinc transporter) member 5 zinc transporter 5 zinc transporter ZTL1 ZnT-5FLJ12496 ZNT5Solute carrier family 30 member 5 ZNTL1hZTL1 ZTL1ZnT-like transporter 1; hZTL1; solute carrier family 30 (zinc transporter), member 5; Solute carrier family 30 member 5; Zinc transporter 5; zinc transporter ZTL1; ZnT-5; ZnT-like transporter 1
Gene Aliases: SLC30A5; UNQ863/PRO1879; ZnT-5; ZNT5; ZNTL1; ZTL1
UniProt ID: (Human) Q8TAD4
Entrez Gene ID: (Human) 64924
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.