Novus Biologicals
Manufacturer Code:NBP16252520UL
Catalog # NBP16252520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC30A1(solute carrier family 30 (zinc transporter) member 1) The peptide sequence was selected form the middle region of SLC30A1. Peptide sequence FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: solute carrier family 30 (zinc transporter) member 1 Solute carrier family 30 member 1 zinc transporter 1 ZnT-1 ZNT1znT-1 ZRC1; solute carrier family 30 (zinc transporter), member 1; Solute carrier family 30 member 1; Zinc transporter 1; ZnT-1
Gene Aliases: SLC30A1; ZNT1; ZRC1
UniProt ID: (Human) Q9Y6M5
Entrez Gene ID: (Human) 7779
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.