Novus Biologicals
Manufacturer Code:NBP159521
Catalog # NBP159521
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC2A13(solute carrier family 2 (facilitated glucose transporter) member 13) The peptide sequence was selected from the middle region of SLC2A13. Peptide sequence GSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: H(+)-myo-inositol cotransporter; H(+)-myo-inositol cotransporter H(+)-myo-inositol symporter Hmit HMITproton (H+) myo-inositol symporter MGC48624 proton myo-inositol cotransporter solute carrier family 2 (facilitated glucose transporter) member 13; H(+)-myo-inositol symporter; proton (H+) myo-inositol symporter; Proton myo-inositol cotransporter; solute carrier family 2 (facilitated glucose transporter), member 13; Solute carrier family 2 member 13
Gene Aliases: HMIT; SLC2A13
UniProt ID: (Human) Q17S07
Entrez Gene ID: (Human) 114134
Molecular Function: carbohydrate transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.