Novus Biologicals
Manufacturer Code:NBP258806
Catalog # NBP258806
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YARYYMRPVLAAHVFSGEEELPQDSLSAPSVASRFIDSHTPPLRPILKKT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Equilibrative nucleoside transporter 3; equilibrative nucleoside transporter 3 ENT3 HCLAP HJCD PHID solute carrier family 29 (nucleoside transporters) member 3; hENT3; solute carrier family 29 (equilibrative nucleoside transporter), member 3; solute carrier family 29 (nucleoside transporters), member 3; Solute carrier family 29 member 3
Gene Aliases: ENT3; HCLAP; HJCD; PHID; SLC29A3; UNQ717/PRO1380
UniProt ID: (Human) Q9BZD2
Entrez Gene ID: (Human) 55315
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.