Novus Biologicals
Manufacturer Code:NBP238763
Catalog # NBP238763
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CNT 2; CNT2SPNT Concentrative nucleoside transporter 2 FLJ21468 HCNT2 HsT17153 MGC138252 Na(+)/nucleoside cotransporter 2 sodium/nucleoside cotransporter 2 Sodium/purine nucleoside co-transporter Sodium-coupled nucleoside transporter 2 solute carrier family 28 (sodium-coupled nucleoside transporter) member 2 Solute carrier family 28 member 2 SPNT1CNT 2; Concentrative nucleoside transporter 2; Na(+)/nucleoside cotransporter 2; Sodium-coupled nucleoside transporter 2; Sodium/nucleoside cotransporter 2; Sodium/purine nucleoside co-transporter; solute carrier family 28 (concentrative nucleoside transporter), member 2; solute carrier family 28 (sodium-coupled nucleoside transporter), member 2; Solute carrier family 28 member 2; SPNT
Gene Aliases: CNT2; HCNT2; HsT17153; SLC28A2; SPNT1
UniProt ID: (Human) O43868
Entrez Gene ID: (Human) 9153
Molecular Function:
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.